PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G010200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GATA
Protein Properties Length: 320aa    MW: 36398.1 Da    PI: 7.4578
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G010200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA24.73.2e-08156184131
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                         Cs C + +Tp+W  gp+g   LCnaCGl+ +
  Brast10G010200.1.p 156 CSYCLSNQTPQWWDGPSGV--LCNACGLRLQ 184
                         9************999885..5******976 PP

2GATA53.82.6e-17249283135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Brast10G010200.1.p 249 CTHCMSHKTPQWRTGPLGPKTLCNACGVRYKSGRL 283
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577169.5E-8149200No hitNo description
PROSITE profilePS501149.684150181IPR000679Zinc finger, GATA-type
SMARTSM004018.2E-5150199IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.0E-8155184IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.345243279IPR000679Zinc finger, GATA-type
SMARTSM004018.1E-15243297IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.94E-14247307No hitNo description
Gene3DG3DSA:3.30.50.102.6E-13248281IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.06E-12248299No hitNo description
PROSITE patternPS003440249274IPR000679Zinc finger, GATA-type
PfamPF003204.3E-15249283IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MDVRRQPNAA AAATAAAATL GDLFPHQPAM DREDNNTEWL SIYLEDCLST HPVSAEQVNQ  60
GDVKPKLPLS SSSNARRKKR SLASVIRDEE EHCFTVFVEP PLLLPDQKHW LAESELILPK  120
KDNDQELVQQ EQEHEEEKKS NASALMLFQQ EQMLICSYCL SNQTPQWWDG PSGVLCNACG  180
LRLQAGNEFV SMERCDQEIS KEQEQGKRQD KRRIKRPAYI DEELPQKKRT KKTTYVNEEL  240
PPEEPVKRCT HCMSHKTPQW RTGPLGPKTL CNACGVRYKS GRLLPEYRPA NSPTFSSYMH  300
SNSHKKVMQM RKGVEHSGQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209216DKRRIKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579113.10.0PREDICTED: GATA transcription factor 2-like
TrEMBLI1IG870.0I1IG87_BRADI; Uncharacterized protein
STRINGBRADI4G01140.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.12e-34GATA transcription factor 4